EFHB Rabbit Polyclonal Antibody TA340363 from OriGene Technologies

Product Specs
ItemEFHB Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA340363
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetEFHB
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-EFHB antibody is: synthetic peptide directed towards the C-terminal region of Human EFHB. Synthetic peptide located within the following region: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE
NCBI Full Gene NameEF-hand domain family member B
NCBI Gene AliasesCFAP21
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

(1) EFHB is a Novel Cytosolic Ca2+ Sensor That Modulates STIM1-SARAF InteractionCellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacologyJanuary 1, 2018Albarran L, Lopez JJ, Jardin I, Sanchez-Collado J, Berna-Erro A, Smani T, Camello PJ, Salido GM, Rosado JA.(N-terminal)) was from Abgent (San Diego, CA, U.S.A.). Rabbit polyclonal anti-EFHB antibody (catalog number TA340363, epitope: amino acids 743-792 of human EFHB (C-terminal)) was from OriGene (Herford, Germany). Horseradish

Be the First to Write a Review!

EFHB Rabbit Polyclonal Antibody

EFHB Rabbit Polyclonal Antibody from OriGene Technologies

Description

OriGene Technologies

Citations (1)

Reviews

EFHB Rabbit Polyclonal Antibody from OriGene Technologies

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map